DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33795

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:173 Identity:50/173 - (28%)
Similarity:80/173 - (46%) Gaps:14/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVINLLLS---DSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTC 75
            :::..||:   ..:..:|..||.|....:|:..:..|.||.:.|.....|.:|.::. |......
  Fly    10 ILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHH-PTNDVVI 73

  Fly    76 VLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYP-FADLVYDGIKSFSNLNHTCPFNHDIIVNQMV 139
            .....:|.:||:|:|:...:|.|.||  ||.|. ...::|...|.|||:||||||..||::..|.
  Fly    74 DYRFLKRENGYKPWLYKKNIDGCRFL--RKPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMY 136

  Fly   140 LNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAEVNLGID 182
            |..: |...|.|:|.|.|:.      .|....::....|:..|
  Fly   137 LRTE-IKAMPYPSGKYMLQI------NWSFYKKIQVVTNISYD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 32/78 (41%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.