DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33769

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:175 Identity:33/175 - (18%)
Similarity:54/175 - (30%) Gaps:56/175 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLP-IKSTTCVL 77
            ||:.:::..|.....|:...||....:|.                 |...|:.|.. |.....|.
  Fly    14 VVVTVVIKQSGPRMTFRAGDCTYNRSTFS-----------------NFSIQIIKTKVIMDMILVT 61

  Fly    78 TLFRRFSGYRPFLFNVT------------VDVCHFLKHRK----RYPFADLVYDGIKSFSNLNHT 126
            ||.:....:..|.|.:|            ::.|..:|..:    |..|..::..|     |...:
  Fly    62 TLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVG-----NFATS 121

  Fly   127 CPFNH------------DIIVNQMVLNDDMISKAPVPNGFYKLRF 159
            ||...            :.:.:.:.|.|..||     ..||..||
  Fly   122 CPIREGYYYLHGWTLDANNVPSFLYLGDYRIS-----GSFYYGRF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 18/105 (17%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.