DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33928

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:165 Identity:52/165 - (31%)
Similarity:85/165 - (51%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YVVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVL 77
            ::...:.|.:|:.: :|.|:|||..:|.|.:.:.|.||...|....|::..::||:|:...|..|
  Fly    14 FMFFQMHLVESSRI-EFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNL 77

  Fly    78 TLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQM---V 139
            .|.:|.:|..||..|.|.|.|..:.:... |....::...|.:||:||:||:.|||||:::   .
  Fly    78 GLHKRSNGLMPFNQNFTFDGCKMVANVGN-PMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHF 141

  Fly   140 LNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVH 174
            :|.......|:|.|.|.......|:|..|..|.||
  Fly   142 VNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 27/80 (34%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472136
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.