DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33792

DIOPT Version :10

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:204 Identity:43/204 - (21%)
Similarity:77/204 - (37%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SYVVINLLLSDSNAL-------FKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLP 69
            |.|.:.:||...|.:       ||.:..:|......|..:. |.||.:......||:...: |..
  Fly     9 SCVYLGVLLCLPNTIFYSNGYFFKIRKTECIANGAYFSNVS-CILKPVNWTRSVLNMDGDI-KEA 71

  Fly    70 IKSTTCVLTLFRRFSG--YRPFLFNVTVDVCHFLKHR------KRYPFADLVYDGIKSFSNLNHT 126
            :......:.:|.:.|.  |:||......|||..||::      ::|..:.|.     .::|:||:
  Fly    72 LTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLT-----EWTNVNHS 131

  Fly   127 CPFNHDIIVNQMV---------------------LNDDMISKAPVPNGFYKLRFIVK--TDGVWR 168
            ||:...:.:..:|                     ...|.:|...:|...||:.|...  ..|:..
  Fly   132 CPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGIHL 196

  Fly   169 GEVEVHAEV 177
            |.|.::.|:
  Fly   197 GLVLIYFEI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 22/109 (20%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 22/105 (21%)

Return to query results.
Submit another query.