DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33775

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:156 Identity:59/156 - (37%)
Similarity:100/156 - (64%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSG 85
            |:..:..:|.|::|..|.:|:...::|:|.:||||.||.:::.::::.|:::......::||::|
  Fly    24 SECRSKSRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINWAMYRRYNG 88

  Fly    86 YRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPV 150
            ::|||:||:.|:|..|.:.....|..||.:.||..|||||:||:||||||:.|..:||.:...|:
  Fly    89 FQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDDFLKTLPL 153

  Fly   151 PNGFYKLRFIVKTDGVWRGEVEVHAE 176
            |.|.||::....|..|||.:|.|..|
  Fly   154 PQGVYKIQLRFATYKVWRVQVAVFIE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 36/77 (47%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 36/81 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471981
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.