DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33768

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:172 Identity:38/172 - (22%)
Similarity:54/172 - (31%) Gaps:60/172 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SYVVINLLLSDSNALFKFKNVKCTCYEKS-FCELKRCE-LKVLGRGIVGLNLHAQVYKLPIKSTT 74
            |.|.:|.:..:.||.| |..:..|....: :.:::..: ||...||.|.:.|             
  Fly    19 SSVTLNRVQCEKNAKF-FATLNVTSVNSTIYADIELLQALKAGFRGHVDVQL------------- 69

  Fly    75 CVLTLFRRFSGYRPF--LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQ 137
                   |.|..:.|  |.....|.|..|...|    ..|....|||.|.               
  Fly    70 -------RLSNAKKFQSLVQADTDYCELLSTLK----DSLFRRWIKSVSK--------------- 108

  Fly   138 MVLNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAEVNL 179
               |.:.:...|||.|.|.|:       .|      |.|:.|
  Fly   109 ---NSNFMENCPVPAGHYYLK-------GW------HVEMGL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 19/79 (24%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.