DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG13193

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:58/134 - (43%) Gaps:11/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHA-QVYKLPIKSTTCVLTLFRRFSGYRPFLF 91
            ||.|:...| .|.:|...|..|  ..:|.:.|::|. :..|..:::|..:|.|......|:. ||
  Fly    36 KFTNISVEC-SKDYCSSIRGWL--TAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQT-LF 96

  Fly    92 NVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPF---NHDIIVNQMVLNDDMISKAPVPNG 153
            :..:|.|..|:...:.....:....:..:.||...||.   ::|  |....|.:..| ...:|.|
  Fly    97 SYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYD--VRNFQLENHSI-PGYLPAG 158

  Fly   154 FYKL 157
            ||:|
  Fly   159 FYRL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 19/80 (24%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.