DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33483

DIOPT Version :10

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:151 Identity:54/151 - (35%)
Similarity:88/151 - (58%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLWSYVVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKS 72
            :|::...|..:.::   :|.:|.|:|||.::|:|.:.:.|.||.:.|....|:|...::|:||..
  Fly    59 VRMYKIPVTKVKIA---SLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITK 120

  Fly    73 TTCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQ 137
            .....:|.:||:||:|||:|:|||.|..|:|.|..|.....|...|..||:||||||:||:||.:
  Fly   121 VKVNFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEK 185

  Fly   138 M---VLNDDMISKAPVPNGFY 155
            :   .:|..:......|:|.|
  Fly   186 LPTNFMNQKVNGDIKFPHGDY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 35/83 (42%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 35/84 (42%)

Return to query results.
Submit another query.