DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and HNRNPDL

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens


Alignment Length:228 Identity:54/228 - (23%)
Similarity:92/228 - (40%) Gaps:31/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PP------MASNNSLNNLCGLSLGS--GGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAI 140
            ||      |...|..:|:...:.||  ..|.:..:|.:     :.:..|..|.:.::|.......
Human   112 PPADSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGK-----MFIGGLSWDTSKKDLTEYLSRF 171

  Fly   141 GPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKV----LNGITVRNKRLKVSYARPGGESIK 201
            |.:..|.|..|..||.|.|:.||.|.......:.:::    |:|..:..||.|   |..|.|..|
Human   172 GEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAK---ALKGKEPPK 233

  Fly   202 DTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNN 266
              .::|..|....:::|:...||.:|.|....:..|..|...||..|:.|...|..::.:.:..:
Human   234 --KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYH 296

  Fly   267 VIPEGG-----SQPLSV----RLAEEHGKAKAA 290
            .|..|.     :||..|    :..::.|:..||
Human   297 QIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/83 (24%)
RRM2_Hu_like 203..281 CDD:240822 19/86 (22%)
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120 2/7 (29%)
RRM1_hnRPDL 149..224 CDD:410152 18/79 (23%)
RRM2_hnRPDL 234..308 CDD:409998 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348 4/17 (24%)
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.