DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and GBP2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_009916.1 Gene:GBP2 / 850346 SGDID:S000000517 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:325 Identity:77/325 - (23%)
Similarity:116/325 - (35%) Gaps:85/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYGN-----------------------NNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMD 42
            ||||                       |:..|||.||       :.:....||        |..:
Yeast     7 MYGNDRSRSRSPVRRRLSDDRDRYDDYNDSSSNNGNG-------SRRQRRDRG--------SRFN 56

  Fly    43 TEFSFPSSSSRRGYND---FPGCGGSGGNGGSAN---NLGGGNMCHLPPMASNNSLNNLCGLSLG 101
            ..:......||  |:|   :|...|..|.|||.:   ..|||.                 |.:||
Yeast    57 DRYDQSYGGSR--YHDDRNWPPRRGGRGRGGSRSFRGGRGGGR-----------------GRTLG 102

  Fly   102 SGGSDDLMNDPRASNTN----LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAF 162
            .....||.....|:..|    :.|..|..|.|..:|..||..:|.:....|:.  ..|:..|...
Yeast   103 PIVERDLERQFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIIT--SKGHHRGMGT 165

  Fly   163 VDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTN-------------LYVTNLPRTI 214
            |:||.....|.||...:|....:::|.|....|..|:.|:.:             :::.|||.::
Yeast   166 VEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSM 230

  Fly   215 TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVR 279
            ....|..:|.:.|.:::.::..| ..|..||...|.|...:|...||...|.:..||  :.|.||
Yeast   231 NWQSLKDMFKECGHVLRADVELD-FNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEG--RVLEVR 292

  Fly   280  279
            Yeast   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/83 (27%)
RRM2_Hu_like 203..281 CDD:240822 21/90 (23%)
GBP2NP_009916.1 RRM1_HRB1_GBP2 121..197 CDD:410184 20/77 (26%)
RRM2_HRB1_GBP2 218..292 CDD:410185 19/76 (25%)
RRM3_HRB1_GBP2 347..425 CDD:410186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.920

Return to query results.
Submit another query.