DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT1G76460

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_565132.2 Gene:AT1G76460 / 843979 AraportID:AT1G76460 Length:285 Species:Arabidopsis thaliana


Alignment Length:350 Identity:75/350 - (21%)
Similarity:113/350 - (32%) Gaps:126/350 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNV 267
            |.::|..|......:.|...|.:||.|::..::.||.|||.:|..||.:...|.|:.|.:....:
plant    24 TKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPI 88

  Fly   268 IPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRS 332
            | :|               .:|...::.:|         .|:||...|...||..|      ||.
plant    89 I-DG---------------RRANCNLASLG---------RPRPPLPYAVIPNMPGR------LRP 122

  Fly   333 LFDAICD------AIFGLDSENFADLLDGLYRRKYHYPYLXLTPQQQQQLLQHQQQAL----GFT 387
            ....|.:      ::.|                  :|||       ||.|..:.||.:    |.|
plant   123 ASPYIGNVQGPRGSLIG------------------NYPY-------QQPLPYNYQQGVVYPYGVT 162

  Fly   388 SSSNNSIGNGNGNDNNMLLYHQQYHQQQTQ--------QQRL---GNVAAHNISPNGSNNNINTS 441
            :                  |..:|...|:|        ||.|   |...|.| ||......::.:
plant   163 A------------------YGPEYMYSQSQGLYSPYMGQQYLQVYGVPGAVN-SPVYQYGQLSQT 208

  Fly   442 NTNNINFNTIRQNGVAALHYLQ------------EQLQLQQPQDQQSQQQQPLTMPSSPPFQQQS 494
            ..|...:..::...|...|.||            ....||.|        .|..:|...|.    
plant   209 IPNGHGYTAVQGYSVPGSHILQLGGPTVSTMTTSSMPALQAP--------YPSGIPGPAPV---- 261

  Fly   495 RQSH---HNGS--SSTLGNQLLAIS 514
             |||   |:..  .||..:|..:.|
plant   262 -QSHIIVHSPQFMQSTASDQTTSYS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093
RRM2_Hu_like 203..281 CDD:240822 21/77 (27%)
AT1G76460NP_565132.2 RRM_RBM24_RBM38_like 24..99 CDD:409818 22/90 (24%)
PABP-1234 <37..245 CDD:130689 58/282 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.