DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and PAB1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_174676.2 Gene:PAB1 / 840313 AraportID:AT1G34140 Length:407 Species:Arabidopsis thaliana


Alignment Length:154 Identity:52/154 - (33%)
Similarity:81/154 - (52%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGIT 182
            |:.|..|.:.:.:::|..:|.|.|.:.:|::.|| .:|.|.||.||.|.|::....|....||..
plant    32 NVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARD-ASGVSKGYGFVQFYSDLSVYTACNFHNGTL 95

  Fly   183 VRNKRLKVSYARPGGESIKD---TNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPR 244
            :||:.:.|......|:..|.   ||:||.||..|.||..|..:||::|.|....:::|. .|:.|
plant    96 IRNQHIHVCPFVSRGQWDKSRVFTNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDG-EGKSR 159

  Fly   245 GVAFVRYNKREEAQEAISALNNVI 268
            ...||.:.|.|.|..||..:|.|:
plant   160 RFGFVNFEKAEAAVTAIEKMNGVV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/78 (31%)
RRM2_Hu_like 203..281 CDD:240822 26/66 (39%)
PAB1NP_174676.2 RRM_SF <1..23 CDD:302621
RRM2_I_PABPs 29..105 CDD:240825 24/73 (33%)
ELAV_HUD_SF 30..296 CDD:273741 52/154 (34%)
RRM3_I_PABPs 118..197 CDD:240826 26/67 (39%)
RRM4_I_PABPs 222..299 CDD:240827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.