DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and PAB3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_173690.1 Gene:PAB3 / 838882 AraportID:AT1G22760 Length:660 Species:Arabidopsis thaliana


Alignment Length:365 Identity:93/365 - (25%)
Similarity:152/365 - (41%) Gaps:83/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA 174
            |.|....||:.|..||:::.:.||...|...|.|::..:||| ::|.|..:.||:|.....:..|
plant   222 NTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRD-QSGNSRCFGFVNFECTEAAASA 285

  Fly   175 IKVLNGITVRNKRLKVSYARPGGESIKD------------------TNLYVTNLPRTITDDQLDT 221
            ::.:|||::.:..|.|..|:...|..::                  .|||:.||..::.|::|..
plant   286 VEKMNGISLGDDVLYVGRAQKKSEREEELRRKFEQERINRFEKSQGANLYLKNLDDSVDDEKLKE 350

  Fly   222 IFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK 286
            :|.:||::....::.:. .|..||..||.|:..|||..|:|.:|..:.  |.:||.:.||:.. :
plant   351 MFSEYGNVTSSKVMLNP-QGMSRGFGFVAYSNPEEALRALSEMNGKMI--GRKPLYIALAQRK-E 411

  Fly   287 AKAAHFMSQMGVVPA-------NVPP--PPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIF 342
            .:.||..:....:.|       :.||  |.|.||.||....|    ..:|...:.:.       :
plant   412 DRRAHLQALFSQIRAPGPMSGFHHPPGGPMPGPPQHMYVGQN----GASMVPSQPIG-------Y 465

  Fly   343 GLDSENFADLLDGLYRRKYHYPYLXLTPQQQQQLLQHQQQA---LGFTSSSNNSIGNGNGNDNNM 404
            |...:....:..|.....:..||    |      ||.|.|.   :||...:.|.           
plant   466 GFQPQFMPGMRPGSGPGNFIVPY----P------LQRQPQTGPRMGFRRGATNV----------- 509

  Fly   405 LLYHQQYHQQQTQQQRLGNVAAHNISP-----NGSNNNIN 439
                    ||..|||:|.:   .|.||     ||::|..|
plant   510 --------QQHIQQQQLMH---RNPSPGMRYMNGASNGRN 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 25/79 (32%)
RRM2_Hu_like 203..281 CDD:240822 25/77 (32%)
PAB3NP_173690.1 PABP-1234 49..644 CDD:130689 93/365 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.