DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT1G17640

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001319031.1 Gene:AT1G17640 / 838341 AraportID:AT1G17640 Length:369 Species:Arabidopsis thaliana


Alignment Length:292 Identity:77/292 - (26%)
Similarity:111/292 - (38%) Gaps:66/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YNNKSSGGRGFGMSH-------SLPSGMDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGG 78
            ||:    .||:..|:       .||   .::|...:...||             |||:|.:.||.
plant     3 YNS----DRGYDDSYHHHVHDEQLP---QSDFEVETFDDRR-------------NGGAAVDTGGI 47

  Fly    79 NMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPI 143
            .|.|                |:....|...|:.|    ..|.|..:..:.|.......|...|.:
plant    48 QMKH----------------SVDHRHSSSSMSSP----GKLFVGGVSWETTAETFANYFGKFGEV 92

  Fly   144 NTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR--PGGESIKDTN-- 204
            ....||.|..||...|:.||.|.   ||..|.|||....|.:.| ||...|  |.|:  |||:  
plant    93 VDSVIMTDRITGNPRGFGFVTFA---DSAVAEKVLEEDHVIDDR-KVDLKRTLPRGD--KDTDIK 151

  Fly   205 -------LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAIS 262
                   ::|..||..:.:|:|...|..||.|::..|:.|..|||.||..||.:...:......|
plant   152 AVSKTRKIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFS 216

  Fly   263 ALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMS 294
              :..:.|.|.:.:.::.||.....:...|.|
plant   217 --DGKVHELGDKQVEIKRAEPKRTGRDNSFRS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/81 (32%)
RRM2_Hu_like 203..281 CDD:240822 22/86 (26%)
AT1G17640NP_001319031.1 RRM_SF 68..138 CDD:418427 24/73 (33%)
RRM_SF 158..236 CDD:418427 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.