DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT5G65260

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_201329.1 Gene:AT5G65260 / 836651 AraportID:AT5G65260 Length:220 Species:Arabidopsis thaliana


Alignment Length:158 Identity:39/158 - (24%)
Similarity:68/158 - (43%) Gaps:41/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DFTSEMDS-QRAIKVL--NGITVRNKRLKV----------SYA--RPGGESIKDTNLYVTNLPRT 213
            |...|:|. ::.:|.:  ....:|..:.||          |.|  :.|.|.:...:::|.|:...
plant    38 DAVKELDEMKKRLKEMEDEAAALREMQAKVEKEMGAQDPASIAANQAGKEEVDARSVFVGNVDYA 102

  Fly   214 ITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSV 278
            .|.:::...|...|::.:..||.||. |:|:|.|:|.:.:.|..|||:. ||.            
plant   103 CTPEEVQQHFQTCGTVHRVTILTDKF-GQPKGFAYVEFVEVEAVQEALQ-LNE------------ 153

  Fly   279 RLAEEHGKAKAAHFMSQMGVVP--ANVP 304
              :|.||:        |:.|:.  .|||
plant   154 --SELHGR--------QLKVLQKRTNVP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 9/47 (19%)
RRM2_Hu_like 203..281 CDD:240822 20/77 (26%)
AT5G65260NP_201329.1 RRM <51..>215 CDD:223796 36/145 (25%)
RRM_II_PABPs 93..164 CDD:409747 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.