DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and GR-RBP3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001330940.1 Gene:GR-RBP3 / 836224 AraportID:AT5G61030 Length:309 Species:Arabidopsis thaliana


Alignment Length:87 Identity:29/87 - (33%)
Similarity:48/87 - (55%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 NKRL--KVSYARPG-GESIK---DTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRP 243
            ||:|  :||.:.|. .::|:   .:.|::..:..::.:|.|...|.|||.:|...::.|:.|||.
plant    16 NKQLNAQVSLSSPSLFQAIRCMSSSKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRS 80

  Fly   244 RGVAFVRYNKREEAQEAISALN 265
            ||..||.:...|.|..||.||:
plant    81 RGFGFVTFTSSEAASSAIQALD 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 6/14 (43%)
RRM2_Hu_like 203..281 CDD:240822 22/63 (35%)
GR-RBP3NP_001330940.1 RRM2_NsCP33_like 41..116 CDD:410187 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.