DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CP31B

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:188 Identity:55/188 - (29%)
Similarity:93/188 - (49%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SDDLMNDPR-ASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSE 168
            |:|.:..|. .....|.|..||.|:..:.|..||...|.:....::.:..|..|.|:.||..::.
plant   100 SEDGVGFPEPPEEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTV 164

  Fly   169 MDSQRAIKVLNGITVRNKRLKVSYARPGGE------SIKDT--NLYVTNLPRTITDDQLDTIFGK 225
            .::::|::..|...|..:||.|:.|.|.|.      .:.|.  .:||.|||..:...:|:.:|.:
plant   165 EEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSE 229

  Fly   226 YGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEE 283
            :|.:|...::.|:.|||.||..||:.:...|...||:||:....||  :.:.|.:|||
plant   230 HGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQNLEG--RAIKVNVAEE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/79 (28%)
RRM2_Hu_like 203..281 CDD:240822 25/79 (32%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 22/78 (28%)
RRM2_NsCP33_like 208..283 CDD:410187 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.