DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Hnrnpab

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_006246407.1 Gene:Hnrnpab / 83498 RGDID:69255 Length:332 Species:Rattus norvegicus


Alignment Length:242 Identity:53/242 - (21%)
Similarity:89/242 - (36%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNT--NLIVN 122
            ||........||    |||...  .|..:.|            |...|.:|..:....  .:.|.
  Rat    34 PGAAAPATPAGS----GGGTTA--APSGNQN------------GAEGDQINASKNEEDAGKMFVG 80

  Fly   123 YLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKV-------LNG 180
            .|..|.:.::|...|...|.:..|.|..|..||.|.|:.|:.|   .||....||       |:|
  Rat    81 GLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF---KDSSSVEKVLDQKEHRLDG 142

  Fly   181 ITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRG 245
            ..:..|:.......|    :|  .::|..|....|::::...||::|.|....:..|....:.||
  Rat   143 RVIDPKKAMAMKKDP----VK--KIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRG 201

  Fly   246 VAFVRYNKREEAQEAISALNNVIPEGGS-------QPLSVRLAEEHG 285
            ..|:.:.:.:..::.:....:.:  .||       ||..|...:::|
  Rat   202 FVFITFKEEDPVKKVLEKKFHTV--SGSKCEIKVAQPKEVYQQQQYG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 23/88 (26%)
RRM2_Hu_like 203..281 CDD:240822 16/84 (19%)
HnrnpabXP_006246407.1 CBFNT 1..75 CDD:311868 12/58 (21%)
RRM1_hnRNPAB 71..150 CDD:410151 22/81 (27%)
RRM2_hnRNPAB 155..234 CDD:409997 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.