DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT5G40490

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_198865.1 Gene:AT5G40490 / 834047 AraportID:AT5G40490 Length:423 Species:Arabidopsis thaliana


Alignment Length:187 Identity:56/187 - (29%)
Similarity:87/187 - (46%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFT 166
            |||..|       |...:.|..|.::.|..|....|...|.|....||:|.|||...|:.||.:.
plant    34 SGGGVD-------SAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYA 91

  Fly   167 SEMDSQRAIKVL--NGITVRNKRLKVSYARPGG----ESIKDTNLYVTNLPRTITDDQLDTIFGK 225
               ||....||:  |.|.: .|::::....|.|    ...|...::|..:|.::.||:....|.:
plant    92 ---DSSVVDKVIQDNHIII-GKQVEIKRTIPRGSMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQ 152

  Fly   226 YGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAE 282
            :|.:.:..|:||..|||.||..||.| :.|:..:.:.|..|.|...|:| :.::.||
plant   153 FGELKEHQIMRDHSTGRSRGFGFVTY-ESEDMVDHLLAKGNRIELSGTQ-VEIKKAE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/81 (30%)
RRM2_Hu_like 203..281 CDD:240822 23/77 (30%)
AT5G40490NP_198865.1 RRM_SF 44..114 CDD:302621 23/73 (32%)
RRM_SF 131..206 CDD:302621 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.