DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT5G09880

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_568220.1 Gene:AT5G09880 / 830848 AraportID:AT5G09880 Length:527 Species:Arabidopsis thaliana


Alignment Length:256 Identity:62/256 - (24%)
Similarity:102/256 - (39%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMD 170
            |:...||......:....:|...|:|::|..|...|.:...|::.|..:..|.|..:::|...|.
plant   157 DEPEADPERDQRTVFAYQMPLKATERDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYDVMS 221

  Fly   171 SQRAIKVLNG-------ITVRNKRLKVSYARP-----GGESIKDTNLYVTNLPRTITDDQLDTIF 223
            ...|| .|:|       :.|:....:.:.|:.     ||....|..|||.||...:::.||..||
plant   222 VPMAI-ALSGQLFLGQPVMVKPSEAEKNLAQSNSTTVGGTGPADRKLYVGNLHFNMSELQLRQIF 285

  Fly   224 GKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEH---- 284
            ..:|.:....:..|..||:.:|..|:::.:.|.::.|..|||..:...| :.:.|....:|    
plant   286 EAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAG-RTIKVSSVSDHIGTQ 349

  Fly   285 -GKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKL-RSLFDAICDAIFG 343
             ...|:|.|....|                ...|.|...|...|:|| ||   .|..:|.|
plant   350 DSAPKSADFDDDDG----------------GGLALNAQSRAMLMQKLDRS---GIATSIVG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 18/91 (20%)
RRM2_Hu_like 203..281 CDD:240822 22/77 (29%)
AT5G09880NP_568220.1 SF-CC1 85..517 CDD:273721 62/256 (24%)
RRM1_RBM39_like 169..241 CDD:240729 16/72 (22%)
RRM2_RBM23_RBM39 267..340 CDD:240730 21/73 (29%)
RBM39linker 366..452 CDD:292157 11/29 (38%)
RRM3_RBM39_like 434..517 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.