DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and EIF3G2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_196219.3 Gene:EIF3G2 / 830487 AraportID:AT5G06000 Length:308 Species:Arabidopsis thaliana


Alignment Length:120 Identity:41/120 - (34%)
Similarity:55/120 - (45%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAI 140
            |.|...::||....       |....:||||  |......|:..:.| |.:|....:|..|||..
plant   175 GTGRAAYVPPSMRE-------GADRKAGGSD--MRSRHDENSVRVTN-LSEDTRGPDLMELFRPF 229

  Fly   141 GPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARP 195
            |.:..|.:..|.||..|.|:.||.|.|..|:||||..|||....|..|:|.::.|
plant   230 GAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVEWSTP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 30/79 (38%)
RRM2_Hu_like 203..281 CDD:240822
EIF3G2NP_196219.3 eIF3g 36..157 CDD:289149
RRM <187..>287 CDD:223796 37/108 (34%)
RRM_eIF3G_like 207..282 CDD:240854 29/75 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.