DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT4G36960

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001154290.1 Gene:AT4G36960 / 829850 AraportID:AT4G36960 Length:379 Species:Arabidopsis thaliana


Alignment Length:322 Identity:68/322 - (21%)
Similarity:125/322 - (38%) Gaps:75/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITV 183
            |:|..:|.|:....|.......|.:..|.:|:|..||.|.|:.:|.|.|..|::.|:|  ....:
plant     5 LVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALK--GEHFL 67

  Fly   184 RNKRLKVSYARPGGE----SIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPR 244
            .|:.|:|..|.|..|    :.|.|.::|..:|.::::....:.|.:||.|....:.:|..:.:.|
plant    68 GNRILEVKVATPKEEMRQPAKKVTRIFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHR 132

  Fly   245 GVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLA----EEHGKAKAAHFMSQMGVVPANVPP 305
            |:.|:.::..:..::.:...:::    |...::|..|    ::|                   ||
plant   133 GIGFITFSSADSVEDLMEDTHDL----GGTTVAVDRATPKEDDH-------------------PP 174

  Fly   306 PPP------QPPAHMAAAFNMMHRDGAMEKLRS------------LFD--------------AIC 338
            .||      :||..:|..|......||.:...|            |:|              .|.
plant   175 RPPPVARMSRPPVAIAGGFGAPGGYGAYDAYISAATRYAALGAPTLYDNPATFYGRGEPTTRGIG 239

  Fly   339 DAIF--GLDSENFADLLDGLYRRKYHY--PYLXLTPQQQQQLLQHQQQALGFTSSSNNSIGN 396
            :.||  .|..|...|.|...:.|..|.  .|:...|::.      ..:..||.:.:.|.:.:
plant   240 NKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRS------GHRGFGFVTFAENGVAD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/77 (31%)
RRM2_Hu_like 203..281 CDD:240822 13/77 (17%)
AT4G36960NP_001154290.1 RRM_SF 4..77 CDD:418427 22/73 (30%)
PABP-1234 5..>378 CDD:130689 68/322 (21%)
RRM_SF 91..166 CDD:418427 13/78 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.