DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and RBP31

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001328008.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:178 Identity:51/178 - (28%)
Similarity:89/178 - (50%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178
            :....|.|..|..|:..:.|..||...|.:....::.:.:|..|.|:.||..:|..:::.|::..
plant   147 SEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKF 211

  Fly   179 NGITVRNKRLKVSYARPGGESIKDT--------NLYVTNLPRTITDDQLDTIFGKYGSIVQKNIL 235
            |...:..:.|.|:.|.|.|...:..        .:||.|||..:.:.:|:.:|.::|.:|:..::
plant   212 NRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVV 276

  Fly   236 RDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEE 283
            .|:.|||.||..||..:..:|..||||||:....||  :.:.|.:|||
plant   277 YDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEG--RAIRVNVAEE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/79 (25%)
RRM2_Hu_like 203..281 CDD:240822 27/85 (32%)
RBP31NP_001328008.1 RRM_HP0827_like 151..228 CDD:240845 19/76 (25%)
RRM_HP0827_like 245..321 CDD:240845 27/77 (35%)
DNA_pol_phi <87..145 CDD:368199
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.