DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CP29

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:315 Identity:59/315 - (18%)
Similarity:102/315 - (32%) Gaps:107/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CHLPPMASNNSLNNLCGLSLGSGGSDDLMND-----PRASNT-----NLIVNYLPQDMTDRELYA 135
            |..|....:..:.|:...|......||:..|     |...|:     .|.|..|..::...:|..
plant    53 CSSPAEYPSRFVRNVAVSSDFEVEEDDMFADGDDSAPVERNSFSPDLKLFVGNLSFNVDSAQLAQ 117

  Fly   136 LFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA---------------------IKVLN 179
            ||.:.|.:....::.|..||.|.|:.||..::..:.:.|                     |:||.
plant   118 LFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYVSRYLCSLLCLYLLIRVLC 182

  Fly   180 GITVRNKRLKVSYARP------------------------------------------------- 195
            |:....:.|:|:...|                                                 
plant   183 GLEFEGRPLRVNAGPPPPKREESFSRGPRSGGYGSERGGGYGSERGGGYGSERGGGYGSERGGGY 247

  Fly   196 -----------------------GGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRD 237
                                   |..|.....|||.||...:.|..|:.:|.:.|.:|:..::.|
plant   248 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEARVIYD 312

  Fly   238 KLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHF 292
            :.:||.:|..||..:..:|.|:||::||....:|    ..:|::|...:.....|
plant   313 RDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDG----RQIRVSEAEARPPRGQF 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/177 (12%)
RRM2_Hu_like 203..281 CDD:240822 24/77 (31%)
CP29NP_001190079.1 RRM_SF 100..194 CDD:302621 20/93 (22%)
RRM_HP0827_like 279..355 CDD:240845 25/79 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.