DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CP33

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:208 Identity:54/208 - (25%)
Similarity:95/208 - (45%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GSGGSDDLMNDPRASNTN-----LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGY 160
            |..|.:::..:.:.:..:     |.|..||..:|..||..:|...|.:...:|:.|..|..|.|:
plant    95 GDEGEEEVEEEKQTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGF 159

  Fly   161 AFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR--PGGES------IKDTN---------LYVT 208
            .||...|..:::.|:::.|...:..:.:||::..  .|||:      |:|.|         :|..
plant   160 GFVTMGSIEEAKEAMQMFNSSQIGGRTVKVNFPEVPRGGENEVMRTKIRDNNRSYVDSPHKVYAG 224

  Fly   209 NLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGS 273
            ||...:|...|...||....::...::.::.|||.||..|:.:...|..|.|::.:|.|..||  
plant   225 NLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALATMNGVEVEG-- 287

  Fly   274 QPLSVRLAEEHGK 286
            :.|.:.||.|..|
plant   288 RALRLNLASEREK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 21/86 (24%)
RRM2_Hu_like 203..281 CDD:240822 22/86 (26%)
CP33NP_190806.1 RRM_HP0827_like 117..193 CDD:240845 21/75 (28%)
RRM_SF 220..295 CDD:302621 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.