DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT3G13224

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_683559.2 Gene:AT3G13224 / 820515 AraportID:AT3G13224 Length:358 Species:Arabidopsis thaliana


Alignment Length:197 Identity:57/197 - (28%)
Similarity:86/197 - (43%) Gaps:27/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEM 169
            :|:..:...||...:.:..|.:|.|:......|...|.|....||||..||...|:.|:.|....
plant     7 NDNFQSGDGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPS 71

  Fly   170 DSQRAIK---VLNGITVRNKRLKVSYARPGGES--IKDTNLYVTNLPRTITDDQLDTIFGKYGSI 229
            ...:.|:   |:||..|..|| .:.....|.:|  ||...::|..:|.|:|:|:|...|.|||::
plant    72 VVDKVIEDTHVINGKQVEIKR-TIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNV 135

  Fly   230 VQKNILRDKLTGRPRGVAFVRYNKREEAQEAIS---------------------ALNNVIPEGGS 273
            |:..::||..|.|.||..||.::..|...|.:|                     :||...|..||
plant   136 VEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYGS 200

  Fly   274 QP 275
            .|
plant   201 HP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/82 (27%)
RRM2_Hu_like 203..281 CDD:240822 28/94 (30%)
AT3G13224NP_683559.2 RRM_SF 21..91 CDD:418427 20/69 (29%)
RRM_SF 110..188 CDD:418427 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.