DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT2G44710

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001324821.1 Gene:AT2G44710 / 819079 AraportID:AT2G44710 Length:809 Species:Arabidopsis thaliana


Alignment Length:163 Identity:40/163 - (24%)
Similarity:78/163 - (47%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DLMNDPR-ASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMD 170
            |::::.| .....:.|..|.:..::.:|..:|..:|.:...||:::.:|..|.|.||:.|.:...
plant   203 DVLHERRKRKEFEIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQ 267

  Fly   171 SQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNIL 235
            ::||:|.|....:..|:..|:.::.     .|| |:|.|:.:..|.:.|......||   .:|: 
plant   268 AKRAVKELKSPMINGKKCGVTASQD-----NDT-LFVGNICKIWTPEALREKLKHYG---VENM- 322

  Fly   236 RDKLT--------GRPRGVAFVRYNKREEAQEA 260
             |.:|        ...||.||:.::.|.:|.:|
plant   323 -DDITLVEDSNNVNMNRGYAFLEFSSRSDAMDA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 19/79 (24%)
RRM2_Hu_like 203..281 CDD:240822 18/66 (27%)
AT2G44710NP_001324821.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.