DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and U2B''

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_180585.1 Gene:U2B'' / 817576 AraportID:AT2G30260 Length:232 Species:Arabidopsis thaliana


Alignment Length:216 Identity:40/216 - (18%)
Similarity:69/216 - (31%) Gaps:74/216 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR- 194
            |.||.||...|.|.....:   ||....|.|:|.|:....:..|::.:......:|.:::.||: 
plant    28 RSLYCLFSQFGRILDVVAL---KTPKLRGQAWVTFSEVTAAGHAVRQMQNFPFYDKPMRLQYAKA 89

  Fly   195 ----------------------------------------------------------PGGESIK 201
                                                                      |.|:...
plant    90 KSDCLAKAEGTFVPKDKKRKQEEKVERKREDSQRPNTANGPSANGPSANNGVPAPSFQPSGQETM 154

  Fly   202 DTN--LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL 264
            ..|  |::.|||...|...|..:|.:|....:..::..|     .|:|||.|....:|..|:..|
plant   155 PPNNILFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAK-----PGIAFVEYEDDVQASIAMQPL 214

  Fly   265 N--NVIPEGGSQPLSVRLAEE 283
            .  .:.|:   .|:.:..|::
plant   215 QGFKITPQ---NPMVISFAKK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 18/124 (15%)
RRM2_Hu_like 203..281 CDD:240822 20/81 (25%)
U2B''NP_180585.1 RRM1_U1A_like 12..88 CDD:240692 16/62 (26%)
RRM2_U1A_like 156..228 CDD:240693 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.