DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AT2G16940

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001189538.1 Gene:AT2G16940 / 816197 AraportID:AT2G16940 Length:610 Species:Arabidopsis thaliana


Alignment Length:210 Identity:48/210 - (22%)
Similarity:86/210 - (40%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAI 175
            ||......:....:....|:|::|..|...|.:...||:.|..:..|.|..:|:|...|....||
plant   225 DPERDQRTVFAYQIALRATERDVYEFFSRAGKVRDVRIIMDRISRRSRGIGYVEFYDTMSVPMAI 289

  Fly   176 KVLNGITVRNKRLKVSYARPGGESIKDT------------------NLYVTNLPRTITDDQLDTI 222
             .|:|..:..:.:.|..:......::.|                  .|||.||...:::|.|..:
plant   290 -ALSGQPLLGQPVMVKPSEAEKNLVQSTTAAAGAGGMLGPYSGGARRLYVGNLHINMSEDDLRKV 353

  Fly   223 FGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEA---------------ISALNN--VIPE 270
            |..:||:....:.||: ||..:|..||::.:.|:|:.|               :||:.:  .:||
plant   354 FESFGSVELVQVPRDE-TGLCKGFGFVQFARLEDARNALNLNGQLEIAGRAIKVSAVTDQTEVPE 417

  Fly   271 GGSQPLSVRLAEEHG 285
            .|....:..|.::.|
plant   418 AGQTQTTGDLDDDDG 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 18/79 (23%)
RRM2_Hu_like 203..281 CDD:240822 26/112 (23%)
AT2G16940NP_001189538.1 SF-CC1 30..607 CDD:273721 48/210 (23%)
RRM1_RBM39_like 232..304 CDD:240729 17/72 (24%)
RRM2_RBM23_RBM39 336..407 CDD:240730 20/71 (28%)
RBM39linker 436..531 CDD:292157
RRM3_RBM39_like 513..596 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.