DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Hnrnpa0

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_084148.1 Gene:Hnrnpa0 / 77134 MGIID:1924384 Length:305 Species:Mus musculus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:71/148 - (47%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTS--EMDSQRAIK--VLN 179
            |.:..|....::..|...|.|.|.:..|.::.:.:|..|..:.||.:::  |.|:..|..  .::
Mouse     9 LFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVD 73

  Fly   180 GITVRNKRL--KVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGR 242
            |.||..||.  :...||||..: |...|:|..|...:.:..|...|.::|::.:..|:.||.:|:
Mouse    74 GNTVELKRAV
SREDSARPGAHA-KVKKLFVGGLKGDVAEGDLIEHFSQFGAVEKAEIIADKQSGK 137

  Fly   243 PRGVAFVRYNKREEAQEA 260
            .||..||.:...:.|.:|
Mouse   138 KRGFGFVYFQSHDAADKA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/83 (27%)
RRM2_Hu_like 203..281 CDD:240822 16/58 (28%)
Hnrnpa0NP_084148.1 RRM1_hnRNPA0 5..83 CDD:409764 19/73 (26%)
RRM_SF 99..178 CDD:418427 16/57 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..211
HnRNPA1 253..>272 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.