DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and hnrnpab

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:250 Identity:50/250 - (20%)
Similarity:91/250 - (36%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDD 107
            ||....:..:....:..|| |.:|..|...|                           .|.|.:|
 Frog    14 TENGHEACDAEAAESKVPG-GQNGAEGDQIN---------------------------ASKGEED 50

  Fly   108 L-----MNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTS 167
            .     ::.|......:.|..|..|.:.::|...|...|.::.|.|..|..||.|.|:.|:.|..
 Frog    51 AGCVPDISSPLTEGVKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKD 115

  Fly   168 EMDSQRAIKV----LNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGS 228
            .....:.::.    |:|..:..|:.......|    ||  .::|..|.....:|::...|..:|.
 Frog   116 AASVDKVLEQKEHRLDGRLIDPKKAMAMKKDP----IK--KIFVGGLNPEAGEDKIREYFETFGE 174

  Fly   229 IVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI-SALNNVIPEGGSQPLSVRLAE 282
            |....:..|..|.:.||..|:.:.:.|..::.: ...:||   .||: ..:::|:
 Frog   175 IEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNV---SGSK-CEIKIAQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 19/83 (23%)
RRM2_Hu_like 203..281 CDD:240822 16/78 (21%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868 11/65 (17%)
RRM1_hnRNPAB 66..140 CDD:241201 18/73 (25%)
RRM2_hnRNPAB 145..224 CDD:241028 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.