DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and dnd1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001037899.1 Gene:dnd1 / 733500 XenbaseID:XB-GENE-1015630 Length:373 Species:Xenopus tropicalis


Alignment Length:228 Identity:54/228 - (23%)
Similarity:93/228 - (40%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA 174
            |.| .|.:.:.:..:|||:.:.:|..||::||.:...|:|..: :|.:.|:|:..:.....:..|
 Frog    75 NAP-VSGSEVFIGKIPQDIYEDKLIPLFQSIGKLYEFRLMMTF-SGLNRGFAYARYIGRRQAVSA 137

  Fly   175 IKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKL 239
            |..|||..: .|...:...|    |.:.:.|.:..||..:....|..|..:..|.|....|....
 Frog   138 IMTLNGYEI-TKGCCIVVCR----STEKSELALDGLPSHLEQPALKNILEEVTSGVSALSLYQSP 197

  Fly   240 TGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQ-----PLSV-----------RLAEEHGKAK 288
            :...:.:|.|:|:....|..|..:|..     |||     ||:|           |.:::|.:.|
 Frog   198 SNESQVLAIVKYDSHRAAAMAKKSLCE-----GSQFLRGLPLTVSWLKTDMRQKLRSSDKHQQPK 257

  Fly   289 AAHFMSQMGVVPANVP----PPPPQPPAHMAAA 317
                      ||:.:|    |..|:.....|.|
 Frog   258 ----------VPSPLPHSGSPEVPKETRLSAVA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/79 (25%)
RRM2_Hu_like 203..281 CDD:240822 21/93 (23%)
dnd1NP_001037899.1 hnRNP-R-Q 39..>238 CDD:273732 44/174 (25%)
DSRM_DND1 277..357 CDD:380745 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.