DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Slirp

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001102977.1 Gene:Slirp / 688717 RGDID:1585290 Length:111 Species:Rattus norvegicus


Alignment Length:118 Identity:27/118 - (22%)
Similarity:50/118 - (42%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 AIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDK 238
            |...:.|:|....|.    .||        ..::..:|.|....:|...|.::|.:.:..:..||
  Rat     2 AASAVKGLTALRSRT----GRP--------IAFIRKIPWTAASSELREHFAQFGHVRRCTVPFDK 54

  Fly   239 LTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAH 291
            .||..||:.:|:::.:||.|.|:...:::|.       .|.:..:..|.|..|
  Rat    55 ETGFHRGMGWVQFSSQEELQNALQEEHHIID-------GVEIHVQPQKPKVLH 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 6/22 (27%)
RRM2_Hu_like 203..281 CDD:240822 18/77 (23%)
SlirpNP_001102977.1 RRM_SLIRP 21..92 CDD:409688 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.