DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Larp7

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_038959070.1 Gene:Larp7 / 686883 RGDID:1592474 Length:578 Species:Rattus norvegicus


Alignment Length:138 Identity:47/138 - (34%)
Similarity:67/138 - (48%) Gaps:29/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RAIKV-------LNGITVRNKRLKVSYARPGGESIKD---TNLYVTNLPRTITDDQLDTIFGKYG 227
            ||:|.       |.|..:|.|       :|.||..||   ..:||..||:.:|...::.:|||.|
  Rat    93 RALKSSSVVELDLEGTRIRR
K-------KPLGERPKDEEERTVYVELLPKNVTHSWIERVFGKCG 150

  Fly   228 SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQP------------LSVRL 280
            ::|..:|...|.||.|:|.|||.:..:|:|.:||..|||...|...:|            .|:|:
  Rat   151 NVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRV 215

  Fly   281 AEEHGKAK 288
            |||..|.|
  Rat   216 AEEKKKKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 8/30 (27%)
RRM2_Hu_like 203..281 CDD:240822 30/89 (34%)
Larp7XP_038959070.1 LARP_7 32..112 CDD:153401 5/18 (28%)
RRM1_LARP7 127..206 CDD:409732 28/78 (36%)
RRM2_LARP7 450..531 CDD:409958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.