DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Zcrb1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_080301.1 Gene:Zcrb1 / 67197 MGIID:1914447 Length:217 Species:Mus musculus


Alignment Length:98 Identity:33/98 - (33%)
Similarity:59/98 - (60%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEA 260
            ||.:...:.:||:|||.::|::.|..||.|||.:|:..|::||.|.:.:||||:.:..::.|...
Mouse     3 GGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSALNC 67

  Fly   261 ISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFM 293
            ..|:||....|  :.:...:|.::|  :||.|:
Mouse    68 TRAINNKQLFG--RVIKASIAIDNG--RAAEFI 96

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity