DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and TRA2B

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:341 Identity:70/341 - (20%)
Similarity:108/341 - (31%) Gaps:98/341 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPR 113
            |.|..:.|.:..  ..|....|||:  |.|......|..|.:..::....|.....|:......|
Human     2 SDSGEQNYGERE--SRSASRSGSAH--GSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRR 62

  Fly   114 ASNTNLIVNYLPQDMTDRELYALFRAIGPIN----TCRIMRDYKTGYSFGYAFVDFTSEMDSQRA 174
            :|               |..|...|:....:    :....|||:..:|..:      |.|.::| 
Human    63 SS---------------RRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSH------SPMSTRR- 105

  Fly   175 IKVLNGITVRNKRLKVSYARPGGESIKDTN--LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRD 237
                              ...|..:..|.|  |.|..|....|:..|..:|.|||.|...:|:.|
Human   106 ------------------RHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYD 152

  Fly   238 KLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPAN 302
            :.:.|.||.|||.:...::|:||....|.:..:|.      |:..:....|..|           
Human   153 QQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR------RIRVDFSITKRPH----------- 200

  Fly   303 VPPPPPQPPAHMA-AAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENF----------------- 349
                .|.|..:|. ..:....|       |..:|...|.  |.|..::                 
Human   201 ----TPTPGIYMGRPTYGSSRR-------RDYYDRGYDR--GYDDRDYYSRSYRGGGGGGGGWRA 252

  Fly   350 ADLLDGLYRRKYHYPY 365
            |...|.:|||:...||
Human   253 AQDRDQIYRRRSPSPY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 10/83 (12%)
RRM2_Hu_like 203..281 CDD:240822 25/79 (32%)
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 26/155 (17%)
RRM_TRA2 117..196 CDD:409798 25/84 (30%)
Linker 193..230 9/60 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 8/50 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.