DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and SRSF1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens


Alignment Length:218 Identity:43/218 - (19%)
Similarity:90/218 - (41%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SGGSDDLMNDPRASN-TNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDF 165
            |||.  ::..|..:| ..:.|..||.|:..:::..:|...|.|.... :::.:.|..|  |||:|
Human     2 SGGG--VIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDID-LKNRRGGPPF--AFVEF 61

  Fly   166 TSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIK----------------------DTNLYVT 208
            ....|::.|:...:|......||:|.:.|.|..:.:                      :..:.|:
Human    62 EDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVS 126

  Fly   209 NLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNV---IPE 270
            .||.:.:...|.....:.|.:...::.||       |...|.:.::|:...|:..|:|.   ..|
Human   127 GLPPSGSWQDLKDHMREAGDVCYADVYRD-------GTGVVEFVRKEDMTYAVRKLDNTKFRSHE 184

  Fly   271 GGSQPLSVRL----AEEHGKAKA 289
            |.:..:.|::    :..:|::::
Human   185 GETAYIRVKVDGPRSPSYGRSRS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/79 (25%)
RRM2_Hu_like 203..281 CDD:240822 16/84 (19%)
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 20/80 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 5/45 (11%)
RRM2_SRSF1 113..196 CDD:410160 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248 2/17 (12%)
Interaction with SAFB1 198..247 1/10 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.