DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and SFPQ

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_005057.1 Gene:SFPQ / 6421 HGNCID:10774 Length:707 Species:Homo sapiens


Alignment Length:620 Identity:111/620 - (17%)
Similarity:197/620 - (31%) Gaps:204/620 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMDTEFSFPSSSSRRGYNDFPGCGGSGGNGGS 71
            ||.....||..|.|  .|..||                   |..|:..|:...|..||....||.
Human   202 PGPGGPKGGKMPGG--PKPGGG-------------------PGLSTPGGHPKPPHRGGGEPRGGR 245

  Fly    72 ANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGG-SDDLMNDPRASNTN----------------- 118
            .         |.||....:......|   |.|| |::.::|......|                 
Human   246 Q---------HHPPYHQQHHQGPPPG---GPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCR 298

  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSF-----GYAFVDFTSEMDSQRAIKVL 178
            |.|..||.|:|:.|...||...|           :.|..|     |:.|:...|...::.|...|
Human   299 LFVGNLPADITEDEFKRLFAKYG-----------EPGEVFINKGKGFGFIKLESRALAEIAKAEL 352

  Fly   179 NGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRP 243
            :...:|.::|:|.:|.....      |.|.||...::::.|:..|.::|.|.:..::.|. .||.
Human   353 DDTPMRGRQLRVRFATHAAA------LSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDD-RGRS 410

  Fly   244 RGVAFVRYNKREEAQEAISALNN-----------VIPEGGSQPLSVRLAEEHGKAKAAHFMSQMG 297
            .|...|.:..:..|::|....:.           ||.|    ||. :|.:|.|..:.   ::|..
Human   411 TGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVE----PLE-QLDDEDGLPEK---LAQKN 467

  Fly   298 VVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKL---------RSLFDAICDAIFGLDSENFADLL 353
            .:.......||:...|....:....|..:::::         :::.||             .|.|
Human   468 PMYQKERETPPRFAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDA-------------KDKL 519

  Fly   354 DGLYRRKYHYPYLXLTPQQQQQLLQHQQQALGFTSSSNNSIGNGNGNDNNMLLYHQQYHQQQTQQ 418
            :......||.... |.   :|.|::.|::                      |...::.|.|:.|:
Human   520 ESEMEDAYHEHQANLL---RQDLMRRQEE----------------------LRRMEELHNQEMQK 559

  Fly   419 QRLGNVAAHNISPNGSNNNINTSNTNNINFNTIRQNGVAALHYLQEQLQLQQPQDQQSQQQQPLT 483
            ::                                            ::||:|.::::.::::  .
Human   560 RK--------------------------------------------EMQLRQEEERRRREEE--M 578

  Fly   484 MPSSPPFQQQSRQSHHNGSSSTLG-----NQLLAISNNNSFNNNSNQSNSFTGNYSNGSAFTSNG 543
            |......::|.|:.... |.|.:|     .:.:.:....:.|......       |.|..|...|
Human   579 MIRQREMEEQMRRQREE-SYSRMGYMDPRERDMRMGGGGAMNMGDPYG-------SGGQKFPPLG 635

  Fly   544 AISGSNFPNNP-----TSSGNFTNNSTNSNPTNSG 573
            ...|..:..||     |.||:...:...:.....|
Human   636 GGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQG 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/101 (22%)
RRM2_Hu_like 203..281 CDD:240822 20/88 (23%)
SFPQNP_005057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..273 25/103 (24%)
3 X 3 AA repeats of R-G-G 9..27
RRM1_PSF 296..366 CDD:241031 20/80 (25%)
RRM2_p54nrb_like 372..451 CDD:240779 19/89 (21%)
NOPS_PSF 442..538 CDD:240583 20/119 (17%)
PTZ00121 <499..>599 CDD:173412 21/184 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..707 18/100 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.