DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and RBMS1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_005246794.1 Gene:RBMS1 / 5937 HGNCID:9907 Length:422 Species:Homo sapiens


Alignment Length:428 Identity:104/428 - (24%)
Similarity:162/428 - (37%) Gaps:90/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRI 148
            ||..|..|.||....|..||. |.|      |.|||.:..||...||::|..|.:..|.|.:.:.
Human    36 PPSPSTTSSNNNSSSSSNSGW-DQL------SKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKA 93

  Fly   149 MRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRT 213
            :.|..|....||.||||.|...:|:|:..|....|:.:..|.....|       ||||::|||.:
Human    94 ILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP-------TNLYISNLPLS 151

  Fly   214 ITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVI---PEGGSQP 275
            :.:.:|:.:...:|.::...||||. :|..|||.|.|....|:.:..|...|...   |.|.|.|
Human   152 MDEQELENMLKPFGQVISTRILRDS-SGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAP 215

  Fly   276 LSVRLAE--EHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSL---FD 335
            ....|.:  :.|:.|..:         .|...|..:|          .||:|.: :|..:   :|
Human   216 TEPLLCKFADGGQKKRQN---------PNKYIPNGRP----------WHREGEV-RLAGMTLTYD 260

  Fly   336 AICDAIFGLDSENFADLLDGLYRRKYHY------------PYLXLTPQQQQQLLQHQQQALGFTS 388
            ....||           .:|.|...|..            ||:  :|....|:.:..::      
Human   261 PTTAAI-----------QNGFYPSPYSIATNRMITQTSITPYIA-SPVSAYQVAKETRE------ 307

  Fly   389 SSNNSIGNGNGNDNNMLLYHQQYHQQQ-------TQQQRLGNVAAHNISPNGSN-NNINTSNTNN 445
              |...|:.....:...:..|.|..|.       :.:..:....|..|||.... ::::..:|..
Human   308 --NKYRGSAIKVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGT 370

  Fly   446 INFNTIRQNGVAALHYLQEQLQLQQ---PQDQQSQQQQ 480
            ....|....|.    ||.:...:|.   |.::.|.|||
Human   371 YMPATSAMQGA----YLPQYAHMQTTAVPVEEASGQQQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/79 (33%)
RRM2_Hu_like 203..281 CDD:240822 26/80 (33%)
RBMS1XP_005246794.1 RRM1_MSSP1 55..140 CDD:409900 29/91 (32%)
RRM2_MSSP1 141..225 CDD:409903 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.