DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Rbms1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_006500003.1 Gene:Rbms1 / 56878 MGIID:1861774 Length:419 Species:Mus musculus


Alignment Length:441 Identity:104/441 - (23%)
Similarity:162/441 - (36%) Gaps:99/441 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRI 148
            ||..|..|.||....|..||. |.|      |.|||.:..||.:.||::|..|.:..|.|.:.:.
Mouse    36 PPSPSTTSSNNNSSSSSNSGW-DQL------SKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKA 93

  Fly   149 MRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRT 213
            :.|..|....||.||||.|...:|:|:..|....|:.:..|.....|       ||||::|||.:
Mouse    94 ILDKATNKCKGYGFVDFDSPAAAQKAVSALKANGVQAQMAKQQEQDP-------TNLYISNLPLS 151

  Fly   214 ITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVI---PEGGS-- 273
            :.:.:|:.:...:|.::...:|||. :|..|||.|.|....|:.:..|...|...   |.|.|  
Mouse   152 MDEQELENMLKPFGQVISTRVLRDS-SGASRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAP 215

  Fly   274 -QPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAI 337
             :||..:.|:...|.:    .:....:| |..|.|....|.|...::                  
Mouse   216 TEPLLCKFADGGQKKR----QNPNKYIP-NGRPWPRDGEAGMTLTYD------------------ 257

  Fly   338 CDAIFGLDSENFADLLDGLYRRKYHY------------PYLXLTPQQQQQLLQHQQQALGFTSSS 390
                     ...|.|.:|.|...|..            ||:. :|....|:.:..::        
Mouse   258 ---------PTTAALHNGFYPSPYSIATNRMITQTSLTPYIA-SPVSAYQVAKETRE-------- 304

  Fly   391 NNSIGNGNGNDNNMLLYHQQYHQQQ-------TQQQRLGNVAAHNISPNGSN-NNINTSNTNNIN 447
            |...|:.....:...:..|.|..|.       :.:..:....|..|||.... ::::..:|....
Mouse   305 NKYRGSAIKVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYM 369

  Fly   448 FNTIRQNGVAALHYLQEQLQLQQ---PQDQQSQQQQ----------PLTMP 485
            ..|....|.    ||.:...:|.   |.::.|.|||          |.|.|
Mouse   370 PATSAMQGA----YLPQYTHMQTAAVPVEEASGQQQVAVETSNDHSPYTFP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/79 (33%)
RRM2_Hu_like 203..281 CDD:240822 26/83 (31%)
Rbms1XP_006500003.1 RRM1_MSSP1 55..140 CDD:240914 29/91 (32%)
RRM2_MSSP2 141..226 CDD:240918 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.