DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Rbms2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_062685.2 Gene:Rbms2 / 56516 MGIID:1861776 Length:383 Species:Mus musculus


Alignment Length:293 Identity:81/293 - (27%)
Similarity:125/293 - (42%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPR 113
            |.:||.|.:.|      |.|..:........|.  ||...|::.|:..|...||||:|.|     
Mouse     4 SVTSRPGISTF------GYNKNNKKLYVAQQMA--PPSPRNSTPNSSGGGGGGSGGNDQL----- 55

  Fly   114 ASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178
             |.|||.:..|....||::|..|.:..|.|.:.:.:.|..|....||.||||.|...:|:|:..|
Mouse    56 -SKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTAL 119

  Fly   179 NGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRP 243
            ....|:.:..|.....|       ||||::|||.::.:.:|:.:...:|.::...|||| .:|..
Mouse   120 KASGVQAQMAKQQEQDP-------TNLYISNLPLSMDEQELEGMLKPFGQVISTRILRD-TSGAS 176

  Fly   244 RGVAFVRYNKREEAQEAISALNN---VIPEG---GSQPLSVRLAE-------------EHGKAKA 289
            |||.|.|....|:.:..|:..|.   ..|.|   .|.||..:.|:             ::|:|..
Mouse   177 RGVGFARMESTEKCEAIITHFNGKYIKTPPGVAAPSDPLLCKFADGGPKKRQSQGRYVQNGRAWP 241

  Fly   290 AHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMH 322
            .:  ..||.:.....|.........||.:::.|
Mouse   242 RN--GDMGGMALTYDPTAALQNGFYAAPYSIAH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 25/79 (32%)
RRM2_Hu_like 203..281 CDD:240822 27/83 (33%)
Rbms2NP_062685.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..56 12/35 (34%)
RRM_SF 53..136 CDD:388407 27/88 (31%)
RRM2_MSSP2 137..222 CDD:240918 28/85 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.