DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and u2af2a

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_005157952.1 Gene:u2af2a / 557103 ZFINID:ZDB-GENE-050706-131 Length:470 Species:Danio rerio


Alignment Length:272 Identity:59/272 - (21%)
Similarity:110/272 - (40%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRA---IG--------PINTCRIMRDYKTGYSFGYAFVDFTSEMDSQ 172
            |.|..:|..:|:..:...|.|   :|        |:...:|.:|.      .:||::|.|..::.
Zfish   144 LYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDK------NFAFLEFRSVDETT 202

  Fly   173 RAIKVLNGITVRNKRLKV----------------SYARPG-------GESIKDT--NLYVTNLPR 212
            :|: ..:||..:.:.||:                |...||       ...:.|:  .|::..||.
Zfish   203 QAM-AFDGIIFQGQSLKIRRP
HDYQPLPGMSENPSVYVPGSLPVGVVSTVVPDSAHKLFIGGLPN 266

  Fly   213 TITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLS 277
            .:.|||:..:...:|.:...|:::|..||..:|.||..|.....:.:||:.||.:  :.|.:.|.
Zfish   267 YLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGM--QLGDKKLL 329

  Fly   278 VRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIF 342
            |:.|....|        ...:...|..|...|.|..|.::.|.|  .|...::..|.:.:.....
Zfish   330 VQRASVGSK--------NTTLTGINQTPVTLQVPGLMNSSVNQM--GGIPTEVLCLMNMVAPEEL 384

  Fly   343 GLDSENFADLLD 354
             ||.|.:.::::
Zfish   385 -LDDEEYEEIVE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/111 (20%)
RRM2_Hu_like 203..281 CDD:240822 22/79 (28%)
u2af2aXP_005157952.1 RRM1_U2AF65 141..222 CDD:240676 19/84 (23%)
RRM2_U2AF65 257..333 CDD:240677 22/77 (29%)
RRM3_U2AF65 370..456 CDD:240678 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.