DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and RBM23

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_024305408.1 Gene:RBM23 / 55147 HGNCID:20155 Length:515 Species:Homo sapiens


Alignment Length:430 Identity:94/430 - (21%)
Similarity:141/430 - (32%) Gaps:143/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YGNNNPGSNNNNGGYPPYGYNNKSSGGRGFG------MSHSLPSGMDTEFSFPSSSSRRGY---- 56
            |.:|...|.:|:|        |::||....|      .|.|.....|.:.|  .|..|..|    
Human    78 YPSNTTSSTSNSG--------NETSGSSTIGETSKKKRSRSHNKSRDRKRS--RSRDRDRYRRRN 132

  Fly    57 --NDFPG--CGGSG-------GNGGSANNLGGGNMCHL--PPMASNNSLNNLCGLSLGSGGS--- 105
              :..||  |....       |:...:.:....:..|.  ||:|:        |...|...|   
Human   133 SRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLAT--------GYRYGHSKSPHF 189

  Fly   106 ----------DDLMNDPRASNT----NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGY 156
                      |:|..:.|.:.|    .|.....|:|:.|     .|.|:|.:...||:.|..:..
Human   190 REKSPVREPVDNLSPEERDARTVFCMQLAARIRPRDLED-----FFSAVGKVRDVRIISDRNSRR 249

  Fly   157 SFGYAFVDF-------------------------TSEMDSQRAIKVLNGITVRNKRLKVSYARPG 196
            |.|.|:|:|                         .|:.:..|...:.|.:...|          |
Human   250 SKGIAYVEFCEIQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGN----------G 304

  Fly   197 GESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 261
            |    ...|||.:|...||:|.|..||..:|.|....:::|..|||.:|..|:.::..|.|:.|:
Human   305 G----PMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRAL 365

  Fly   262 SALNN-----------------------VIPE----------GGSQPLSVRLAEEHG------KA 287
            ..||.                       ..|:          ||...|..:|||..|      .|
Human   366 EQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGGRFQLMAKLAEGAGIQLPSTAA 430

  Fly   288 KAAHFMSQMGVVPAN--VPPPPPQPPAHMAAAFNMMHRDG 325
            .||...:|...:..|  ||.....|.|...:..:...|:|
Human   431 AAAAAAAQAAALQLNGAVPLGALNPAALTGSLGHGKGREG 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/108 (19%)
RRM2_Hu_like 203..281 CDD:240822 27/110 (25%)
RBM23XP_024305408.1 RRM 143..514 CDD:330708 75/355 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.