DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and zcrb1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001017589.2 Gene:zcrb1 / 550251 ZFINID:ZDB-GENE-041210-114 Length:218 Species:Danio rerio


Alignment Length:134 Identity:37/134 - (27%)
Similarity:63/134 - (47%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEA 260
            ||.:...:.:||:|:|.::|:..:..:..|||.:|:..|::||.|...:|||||.:..||.|...
Zfish     3 GGLAPSKSTVYVSNIPFSLTNSDMHKLCSKYGKVVKVTIVKDKHTRMSKGVAFVLFLDRESAYNC 67

  Fly   261 ISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMG------------------VVPANV---- 303
            ..:|||....|  :.:...:|.::|  :||.|:.:..                  ..|.|:    
Zfish    68 SRSLNNKQLFG--RMVKASIAIDNG--RAAEFIRKRNYTDKSKCYECGEEGHLSYACPKNLLGER 128

  Fly   304 -PPP 306
             |||
Zfish   129 EPPP 132

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity