DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and sf3b6

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001017249.1 Gene:sf3b6 / 550003 XenbaseID:XB-GENE-972887 Length:125 Species:Xenopus tropicalis


Alignment Length:116 Identity:32/116 - (27%)
Similarity:49/116 - (42%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIK 176
            |...|..|.:..||..:|..|:|.:|...|||...|:....:|.   |.|:|.:....|::.|..
 Frog    14 PPEVNRILYIRNLPYKITGEEMYDIFGKYGPIRQIRVGNTPETR---GTAYVVYEDIFDAKNACD 75

  Fly   177 VLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYG 227
            .|:|..|.|:.|.|.|        .:.|.....:.....::||..:..|||
 Frog    76 HLSGFNVCNRYLVVLY--------YNANRAFQKMDTKKKEEQLKLLKEKYG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/79 (30%)
RRM2_Hu_like 203..281 CDD:240822 6/25 (24%)
sf3b6NP_001017249.1 RRM_SF3B14 17..93 CDD:409687 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.