DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and RBM47

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001092104.1 Gene:RBM47 / 54502 HGNCID:30358 Length:593 Species:Homo sapiens


Alignment Length:510 Identity:97/510 - (19%)
Similarity:160/510 - (31%) Gaps:205/510 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITV 183
            :.|..:|:|:.:.||..:|.|:|.|...|:|.|: .|.:.|||||.:..:.:::||::.||...:
Human    73 VFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDF-DGKNRGYAFVMYCHKHEAKRAVRELNNYEI 136

  Fly   184 RNKRL------------------------------------------------------------ 188
            |..||                                                            
Human   137 RPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEY 201

  Fly   189 -------------------------KVSYARPG---GESIKDT--NLYVTNLPRTITDDQLDTIF 223
                                     .|.:|.|.   .|.:.:|  .|||.||....|:|.:...|
Human   202 ESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSF 266

  Fly   224 GKY--GSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK 286
            |::  |.:.:...:||        .|||.:..||:|..|::.||....||..  |.|.||:...|
Human   267 GQFNPGCVERVKKIRD--------YAFVHFTSREDAVHAMNNLNGTELEGSC--LEVTLAKPVDK 321

  Fly   287 AKAAHFMSQM---GVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSEN 348
            .:.:.:....   |...|      .|.|:::.:                     ||.        
Human   322 EQYSRYQKAARGGGAAEA------AQQPSYVYS---------------------CDP-------- 351

  Fly   349 FADLLDGLYRRKYH-YPYLXLT-PQQQQQLLQHQQQALGFTSSSNNSIG----------NGNGND 401
                    |...|: |||. |. |.:...:.....:..|..::.|.:.|          .|.|  
Human   352 --------YTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRG-- 406

  Fly   402 NNMLLYHQQYHQQQTQQQRLGNVAAHNISPNGSNNNINTSNTNNINFNTIRQNGVAA-------- 458
                 .:.:||:.:.:||..|    :.:.|   |..|.|.|...|...|:....:.|        
Human   407 -----IYSRYHEGKGKQQEKG----YELVP---NLEIPTVNPVAIKPGTVAIPAIGAQYSMFPAA 459

  Fly   459 ----------LHYLQEQLQ--LQQPQDQQSQQQQPL----------TMPSSPPFQ 491
                      :|.::..:.  ..||....:......          |:.:.||||
Human   460 PAPKMIEDGKIHTVEHMISPIAVQPDPASAAAAAAAAAAAAAAVIPTVSTPPPFQ 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 28/165 (17%)
RRM2_Hu_like 203..281 CDD:240822 26/81 (32%)
RBM47NP_001092104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
hnRNP-R-Q 21..593 CDD:273732 97/510 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.