DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Eif3g

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_058572.2 Gene:Eif3g / 53356 MGIID:1858258 Length:320 Species:Mus musculus


Alignment Length:116 Identity:35/116 - (30%)
Similarity:55/116 - (47%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PPMASNNSLNNLCGLSLGSGGS---DDLMNDPRA-SNTNLIVNYLPQDMTDRELYALFRAIGPIN 144
            |..|:.:........||..|.|   :.:..:.|| .|..:.|..|.:|..:.:|..|||..|.|:
Mouse   202 PVQAAQSKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSIS 266

  Fly   145 TCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARP 195
            ...:.:|..||.|.|:||:.|....|:.|||..::|....:..|.|.:|:|
Mouse   267 RIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/79 (33%)
RRM2_Hu_like 203..281 CDD:240822
Eif3gNP_058572.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
eIF3G 62..173 CDD:240597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..233 5/28 (18%)
RRM_eIF3G_like 240..316 CDD:240854 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.