DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Hrb87F

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:226 Identity:61/226 - (26%)
Similarity:94/226 - (41%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MASNNSLNNLCGLSLGSGGSDD--LMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRI 148
            ||..|..|         |..||  .:.:|.... .|.:..|....||..|.|.|...|.|....:
  Fly     1 MAEQNDSN---------GNYDDGEEITEPEQLR-KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVV 55

  Fly   149 MRDYKTGYSFGYAFVDFTSE--MDSQRAIK--VLNGITVRNKRLKVSYARP--------GGESIK 201
            |:|.||..|.|:.|:.::..  :|:.:..:  .::|.||..||     |.|        .|.::|
  Fly    56 MKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKR-----AVPRQEIDSPNAGATVK 115

  Fly   202 DTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNN 266
              .|:|..|.....::.|...|..:|.||..||:.||.||:.||.||:.::..:...:.|....:
  Fly   116 --KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTH 178

  Fly   267 VIPEGGSQPLSVRLAEEHGKAKAAHFMSQMG 297
            .|.   ::.|.|:      ||.|...|.:.|
  Fly   179 SIK---NKTLDVK------KAIAKQDMDRQG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/91 (26%)
RRM2_Hu_like 203..281 CDD:240822 22/77 (29%)
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/81 (28%)
RRM_SF 116..188 CDD:302621 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.