DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and NONO

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001138880.1 Gene:NONO / 4841 HGNCID:7871 Length:471 Species:Homo sapiens


Alignment Length:421 Identity:77/421 - (18%)
Similarity:158/421 - (37%) Gaps:129/421 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PPMASNNSLNNLCGLSLGSGGSDDLMNDPR------ASNTNLIVNYLPQDMTDRELYALFRAIGP 142
            ||:.:|....:    |...|.:.||.|..:      ...:.|.|..||.|:|:.|:..||...|.
Human    39 PPIPANGQQAS----SQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGK 99

  Fly   143 INTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYV 207
            .....|.:|.      |:.|:...:...::.|...|:.:.:|.|:|:|.:|      ....:|.|
Human   100 AGEVFIHKDK------GFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFA------CHSASLTV 152

  Fly   208 TNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI------SALNN 266
            .|||:.::::.|:..|..:|.:.:..::.|. .|||.|...|.::.:..|::|:      |.|..
Human   153 RNLPQYVSNELLEEAFSVFGQVERAVVIVDD-RGRPSGKGIVEFSGKPAARKALDRCSEGSFLLT 216

  Fly   267 VIPEGGSQPLSV----RLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAM 327
            ..|    :|::|    :|.:|.|..:.....:|........||...||              |:.
Human   217 TFP----RPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQP--------------GSF 263

  Fly   328 EKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHY-----PYLXLTPQQQQQL---LQHQQQAL 384
            |                                |.|     ..: :..|||.|:   ::..::.|
Human   264 E--------------------------------YEYAMRWKALIEMEKQQQDQVDRNIKEAREKL 296

  Fly   385 GFTSSSNNSIGNGNGNDNNMLLYHQQYHQQQTQQQRLGNVAAHNISPNGSNNNINTSNTNNINFN 449
            .....:..       :::.::|..|...::|.:.:|:..:  ||                    .
Human   297 EMEMEAAR-------HEHQVMLMRQDLMRRQEELRRMEEL--HN--------------------Q 332

  Fly   450 TIRQNGVAALHYLQEQLQLQQPQDQQSQQQQ 480
            .:::         ::||:|:|.::::.::::
Human   333 EVQK---------RKQLELRQEEERRRREEE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 21/79 (27%)
RRM2_Hu_like 203..281 CDD:240822 21/87 (24%)
NONONP_001138880.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 3/15 (20%)
DBHS 54..373 73/402 (18%)
RRM1_p54nrb 73..143 CDD:410001 20/75 (27%)
RRM_SF 149..228 CDD:418427 21/83 (25%)
NOPS_p54nrb_PSF_PSPC1 219..311 CDD:240581 20/148 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.