DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and ncbp2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001006879.1 Gene:ncbp2 / 448671 XenbaseID:XB-GENE-1005786 Length:153 Species:Xenopus tropicalis


Alignment Length:61 Identity:20/61 - (32%)
Similarity:33/61 - (54%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALN 265
            |||.||....|::|:..:|.|.|.:.:..:..||:.....|..||.|..|.:|::|:..:|
 Frog    39 LYVGNLSFYTTEEQIHELFSKSGDVKKIVMGLDKIKKTACGFCFVEYYTRTDAEQAMRFIN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093
RRM2_Hu_like 203..281 CDD:240822 20/61 (33%)
ncbp2NP_001006879.1 RRM_NCBP2 39..116 CDD:240686 20/61 (33%)
mRNA cap-binding. /evidence=ECO:0000250 109..113
mRNA cap-binding. /evidence=ECO:0000250 120..124
mRNA cap-binding. /evidence=ECO:0000250 130..131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.